Hamster Menggunakan Toilet Sendiri

Percaya tidak kalau hamster punya toiletnya sendiri, dan hamster kalau pee atau poop, ya di toiletnya itu? Masa sih? :argh:
Well, hamster pada umumnya adalah hewan yang bersih. Tidak seperti tikus, hamster di alamnya hidup di dalam lubang jadi naluri mereka untuk pergi ke toilet pada satu tempat. Semua hewan dapat dilatih untuk memakai toilet/kotak kotoran. Dan lebih mudah mengajar mereka pada waktu masih muda.

Ada cara membuat kandang hamster yang terkenal “bau” menjadi baunya berkurang. Percaya atau tidak, hamster dapat melatih mereka sendiri untuk memakai toilet/litter box, meskipun bantuan dari pemilik sangat membantu. Setiap rumah hamster modern seharusnya memiliki satu litter box/toilet. Ada beberapa jenis toilet/litter box yang dijual di pasaran.

Masalah Salah Penggunaan
Sering kali Anda menemukan bahwa hamster Anda menggunakan toiletnya untuk lainnya. Ada yang menggunakan toiletnya sebagaimana mestinya dan ada pula yang menggunakannya sebagai tempat untuk menyimpan makanan, makan dan tidur. Pemecahannya adalah dengan memberi bekas tutup toples seperti tutup peanu
t-butter dan taruhlah dengan kotoran di dalamnya. Biarkan hamster Anda makan di litterboxnya. Sisa-sisa kulit biji-bji yang ditinggal di toilet menunjukan bahwa hamster mengetahui bagaimana toilet ini sering dibersihkan dan sisa kulit bijian hilang.. Tetapi jangan biarkan hamster menyimpan apa saja di dalam toilet. Jika Anda membersihkan toilet secara teratur, meskipun hamster Anda tidak memakainya, ini akan membuat hamster tertarik untuk membuat sampah atau sisa-sisa kulit biji bijian dan kencing di toilet, tetapi tidak kotoran(biasanya kering dan tidak begitu berbau). Memberi hamster lebih dari satu di beberapa tempat juga ide yang bagus.

Masalah utama, Anda mungkin menemukan mereka bersarang di toilet. Ini tidak dapat dirubah jadi coba saja berikan tempat tinggal alternatif. Kotak persembunyian, terowongan, rumah-rumahan. Menaruh makanan cemilan, alas dan bahan yang lembut juga dapat membantu.

Penempatan
Perhatikan penempatan toilet pada kandang. Penempatan sangat penting untuk toilet hamster. Kebanyakan hamster akan ke pojok yang terdekat dengan botol airnya. Mereka biasanya grooming di sana. Jadi tempat ini jelas menjadi pilihan terbaik. Tetapi Anda harus menempatkan dimana hamster Anda biasa kencing. Juga dapat dibantu dengan menaruh sebagian serbuk/alas yang telah dikencingi hamster ke dalam toilet sebagai tanda atau pemancing.

Pembersihan
Untuk pasir toiletnya, Anda dapat membeli pasir toilet hamster atau biasa dikenal dengan pasir zeolit. Harganya relati murah. Setiap hari atau dua hari sekali, kotoran harus dibersihkan dengan skop yang tersedia. Jika tidak ada, Anda dapat memakai garpu plastik. Pada waktu membersihkan kandang, buang semua pasir toiletnya dan bersihkan toiletnya lalu ganti dengan pasir toilet yang baru
.

Intinya, untuk memiliki rumah hamster yang modern, perlu dilengkapi dengan toilet yang berventalasi cukup. Kebanyakan toilet hamster dijual dengan skopnya. Jika tidak ada Anda dapat memakai garpu plastik. Dengan pelatihan toilet ini, Anda dapat membersihkan kandang tidak sesering seperti Anda lakukan sebelumnya dan baunya pun berkurang dan lebih baik daripada sebelumnya.

Referensi: http://forum.megaxus.com/

92 comments:

pakto said...
July 27, 2009 at 9:15 AM

kira2 kuburan khususnya ada nggak ya he..he

ezoel said...
July 27, 2009 at 9:18 AM

Kalo aku udah lama dikasih box di kandang hamsternya Des, padahal boxnya aku isi pasir aja untuk toilet, tapi hamsternya malah masukin serbuk kayunya ke situ terus kadang malah tidur disitu juga :-D

Pasar burungnya ada di seteleh PGJ, jadi PGJ lewat dikit...
Sebelum halte busway pasar jatinegara [halte busway terakhir sebelum kampung melayu dari arah ancol]
Maaf bgt ya Des, aku gak nanya2 kandang sama hamsternya, soalnya aku ke situ pagi jadi masih rame, sabtu pula...
aku aja bingung yang mana pembeli yang mana penjual =D
Kalo kamu sempet mampir aja kesana ya...

sanur said...
July 27, 2009 at 9:34 AM

jadi tertarik melihara hamster selain kucing....keliatan lebih menarik kayanya yaaa..apalagi liat bentuknya wuuih gemesin banget....

dulu pernah beli tapi dikasihin ke ponakan soalnya maksa pengen punya.......


byw boleh juga nih artikel2nya kalo diterbitin..udah pernah dikirim ke penerbit ?

my bro said...
July 27, 2009 at 10:00 AM

situsnya luthu ^_^, orangnya luthu juga nda ;))

kira said...
July 27, 2009 at 10:17 AM

hamster bisa blogging juga gak?

bayunature said...
July 27, 2009 at 10:46 AM

jadi binatang juga kalau dilatih untuk teratur bisa juga ya,. bisa jadi binatang sirkus ga, Des?

jaya said...
July 27, 2009 at 10:58 AM

dirumahQ ada kucing juga... bahaya ga ya klw melihara hamster..??? ntar hamsternya tidur didalam perut kucingQ lagi... hehehe :D

sifa said...
July 27, 2009 at 11:15 AM

hai desti, numpang baca sob,,
wah pinter juga ya hamster ni biar pun dia hewan toh buktinya dia mampu menggunakan toilet sendiri he..he..

bunga raya said...
July 27, 2009 at 12:00 PM

wah aku malah ga pernah ke toilet padahal manusia wakakakakaka....aku WCnya panjang bngt wc terpanjang di dunia mau tau mau tau........?

h said...
July 27, 2009 at 1:17 PM

Aku nggak punya hamster jadi kurang tau deh

arunaspot said...
July 27, 2009 at 2:21 PM

toilet hamster tarif nya 1000 rupiah juga ga yah?

arunaspot said...
July 27, 2009 at 2:21 PM

hyahahaha... kabar baek des,,, ;)

km gimana ?

arunaspot said...
July 27, 2009 at 2:22 PM

wah wah alexa rank kamu ngeri aja ya des,,,

pengeeeeeeeen.... ^^

arunaspot said...
July 27, 2009 at 2:23 PM

sukses ya des bloggingnya...

aku lagi masa2 bosen nih...
^^

Daily Project said...
July 27, 2009 at 3:05 PM

ya sudah seharusnya begitu kan des hehe..
btw linkmu already add at my silly blog

Hendra Lesmana said...
July 27, 2009 at 3:08 PM

whuh.... gak nyangka aku! hamster punya toilet sendiri... tp mending gitu sih ya... daripada rebutan dengan toilet kita hehehe

enggalicious said...
July 27, 2009 at 3:13 PM

omg ,,
klo geto orang2 yang poop di pinngir kali kalah ama hamster dunk ..
wakwakakakk, ,

Ares Shadux's said...
July 27, 2009 at 3:18 PM

kalo gitu hamster termasuk hewan yang suka kebersihan.

kibagus said...
July 27, 2009 at 3:24 PM

HAMSTER EMANG AMOOY......!
DES SEKALIAN AJA DIBUATIN RUMAH.......
TRUSS KAMU BISA BIKIN "PERKAMPUNGAN HAMSTER"...
WAAAAHHH ... PASTI OCLE....!!!

Ryan said...
July 27, 2009 at 4:44 PM

Wow nice info sist btw bukan hanya manusia doanx yg punya toilet xixixi...:-)

Bisa buat referensi bila ingin pelihara hamster kelak huehuehue...^-^

irawan said...
July 27, 2009 at 5:25 PM

baru tau hamster punya toilet....he..he...

kira2 toiletnya sperti apa ya... kasih gambar ato foto hamsternya jg donk mbak... :)

makasih jg dah mo mampir ke blog beta...

klo gak keberatan beta minta dukungan jg alias kasih komentar blog kontes beta...halah... kali aja dapat domain gratis...Ngarepin Mode : ON

http://ira-one.co.cc/2009/07/fenomena-mbah-surip-di-tahun-2009/

klo mo ikutan jg bisa.. :D

Tipspack said...
July 27, 2009 at 7:05 PM

Wuuuiiiihhh....
Ternyata toilet training bukan hanya berlaku pada anak manusia ya... hehe...

Tipspack said...
July 27, 2009 at 7:05 PM

Susahan ngajarin hamster, atau ngajarin bayi, Des???

Tipspack said...
July 27, 2009 at 7:08 PM

DUAPULUH KLIMAKS...
Hehehe...
Ckck... Kayanya aku cuma sanggup pelihara ikan...
Repot euy, Ngajarin hamster E'e' segala.... ^_^

Tipspack said...
July 27, 2009 at 7:10 PM

Des, Tu si Aruna mau ngelamar jadi tukang jaga toilet hamster, katanya Rp 1000,-/sekali ritual... :D

Bayu 'The Maniac' said...
July 27, 2009 at 7:50 PM

sori tlat datengnya sob ...
hehehe ...

ngerepotin banget yah tu hamster ...

pengembara said...
July 27, 2009 at 8:41 PM

aku percaya karena binatang kalau dilatih dia juga akan mengerti,

itu pendapat saya lho....

cahyadi said...
July 27, 2009 at 8:50 PM

toilet hamster??? wah bentuknya kayak apa tuh mbak...?

ajir said...
July 28, 2009 at 12:07 AM

wah bagus!
jd desti ga rebutan toilet am hamsternya :D

blog sedekah said...
July 28, 2009 at 6:44 AM

mana pic toilet-nya dest??
hamster termasuk hewan cerdas jg yah?

Game Zone said...
July 28, 2009 at 10:54 AM

Yayayaya bener, sy udah banyak liat di petshop ad wc kecil bwt hammy.

Ohya mba' Desti sy punya posting SPESIAL buat sampeyan. Nih :

http://newgamecollection.blogspot.com/2009/07/hamster-heroes.html

Tips dan Trik Komputer said...
July 28, 2009 at 10:55 AM

Hahaha lucu juga, ada g ya toilet umum buat hamster? hehe

uguns said...
July 28, 2009 at 12:49 PM

wow keren hamster punya toilet sendiri, jadi mandiri donk...

ShapYdoLLs said...
July 28, 2009 at 1:45 PM

Kadang gw ngga pake garpu... masles.. se pasir2nya gw buang deh hahaha.. hasilnya pasirnya cepet asbis --' untung murah

arunaspot said...
July 28, 2009 at 4:58 PM

helloooooo.... mampir lagi aaaaaa

kepriwe kabare ?

wkwkwkwkw

arunaspot said...
July 28, 2009 at 4:59 PM

desdesdes...hapeku iLang des...
hikshikshiks...

arunaspot said...
July 28, 2009 at 5:00 PM

desdesdes...mau si alexarank tinggi...
hikshikkshsikshsksh

arunaspot said...
July 28, 2009 at 5:06 PM

kokitutoiletmiripamapesawatangakasasayawaktupertamakalitibadibumiyah,wahwahwahbangsahamsterternyatatelahmencuriteknologidarispesiessayakurangajaynantisaiabalascuriteknologitempatpipismerekahuhuhuhu...

gaelby said...
July 28, 2009 at 6:00 PM

Hamsterhouse Hamstertoys Hamsterfriends Hamstertoilet...

hadir bos...:)

HATURUA (Hobert Noya) said...
July 28, 2009 at 10:13 PM

Lucu jg ya.. Hamster punya toilet sendiri..
Hehehehe... :)

arunaspot said...
July 28, 2009 at 11:30 PM

aku mau ajak kawan2 istimewaku di dunia perbloggeran yg secara ketat aku seleksi pake celana dalamnya Cindy Crawford (biar ketat nya meyakinkan). Dan makhluk yg terpilih adalah sebagai berikut (disertai alasan mengapa aku pilih mereka sebagai korbanku, hyahaha) :

Desti HamsterLand –> wajib nih! bidadarinya blogger!
Tipspack –> klo ini emang kudu, klo ga kumat ayannya
Andiebuytank –> ini juga kudu, kingkong keramat!
Dany Website –> ini mirip nama sobatku yg iLang…
Iwan Laptop8 –> namanya mirip bosku, sumpeh..


CEK POSTING TERAKHIRKU SOAL DAPET AWARD (LAGI)

ajir said...
July 29, 2009 at 1:04 AM

gimana sih bentuk kotoran hamster..
jd pengen tau :D

arkasala said...
July 29, 2009 at 1:56 AM

seru banget ya ngurus hamster ini. Mbaknya ini termasuk orang yang telaten juga sih ya. Sip, hobby yang seru. Salam

genial said...
July 29, 2009 at 4:38 AM

twewwwwwwwwwwwwww... telad gw...!!!
ck ck ck... punya toiled segala?!?!? kalah gw, gw ajja msih numpang di toiled ortu :p

mampir lagi saiia nii sambil bawa teh anget sama pisang goreng panas :) interested?!??!?

lokamaya said...
July 29, 2009 at 8:37 AM

Haduh..begitu rajinnya si Hamster..sekali ke toilet byar berapa yak..hahahaha...sukses terus sob..

Bisnis Online said...
July 29, 2009 at 9:02 AM

hahaha lucu banget yach :)

ivenx oy'z said...
July 29, 2009 at 10:43 AM

yapz ...mantab ni infonya ....
Oya ,,,sorri bru blz...klw soal READ More aku dpt dri template... coba ja cari di google kata kuncinya " Cara pasang Auto Read More terbaru (Part 2)"....

dewi said...
July 29, 2009 at 12:17 PM

lucu banget toilet hamsternya...

devianty said...
July 29, 2009 at 12:20 PM

hamster imut, lucu, peralatannya juga pada lucu, mungil gitu, sukses yah...

fachrizal said...
July 29, 2009 at 1:15 PM

Rumahnya kayak mouse....^_^

mantro said...
July 29, 2009 at 1:49 PM

mampir blogku yaa..... dtgu komentnya....

berita unik said...
July 29, 2009 at 5:28 PM

waduh koq makin banyak aksesoris bwt hamster sih
hahaha...
eksklusif banget yah

arunaspot said...
July 29, 2009 at 5:49 PM

bagaimanapun juga, akan saia curi kembali pesawat luar angkasa saia yg sudah dg biadab di konversi menjadi toilet hamster tersebut...hufftt...*kumat

satria said...
July 29, 2009 at 5:58 PM

wah hebat juga ya neh hamster bisa tau ke wc hihihi

draxc0la said...
July 29, 2009 at 5:59 PM

ohh gitu ya cara merawat kotoran hamster.. makasih buat info nya neh..

Andie Gokil said...
July 29, 2009 at 6:08 PM

mantab bener nih bos blognya.
ntar kalo ak pelihara hamster, pasti sering2 kesini.
:D

eh, sekalian
ada yang baru di blogku.
koment yak.
salam keyboard!!!

nindrianto said...
July 29, 2009 at 6:24 PM

wuih, visitornya rame banget....salut...padahal soal hamster doang..hihi...salam ya buat hamster2nya...

Irfan Melodic - No Chairs and Tables for Five Years of Study said...
July 29, 2009 at 6:45 PM

Ih luthu-nya.... Masak hamster punya toilet sendiri. Hamster beli toilet khusus hamster dimana ya? Trus pake kurensi uang apa ya?

Best regards,

Irfan Melodic Nugroho
Melodramatic Mind

Facts on the Recent News

alamendah said...
July 29, 2009 at 11:59 PM

walah dalah...
punya toilet sendiri?

angga chen said...
July 30, 2009 at 1:26 AM

waduh pengetahuan tentang hamsternya oke juga nih...kursusu dimana ya ?

nathalia site said...
July 30, 2009 at 7:34 AM

what...hamster punya toilet ndiri?wah, pintar donk hamsternya, manusia aja yang punya toilet sering "ngebom" sembarangan, nah sekarang jadi pertanyaan hayo pintaran mana manusia sam hamster?

ivenx said...
July 30, 2009 at 9:10 AM

wah boleh jiga ni info hamternya...
baru baru tau ternyata hamster punya toilie ndiri...

Animation, money 'n' more said...
July 30, 2009 at 9:30 AM

wkwkwkw kirain manusia aja yang BAB di toilet ternyata hamster juga punya......

iwan said...
July 30, 2009 at 9:59 AM

Ternyata bukan kucing aja yg bisa di ajarin BAB di tempatnya, Hamster juga bisa ya.
Berarti kalo orang BAB di kali brarti tuh org lebih oon dari binatang , hehehe

rachmat said...
July 30, 2009 at 10:44 AM

berarti hamster bisa dilatih tempat pupnya ya,
penasaran nih, tp gimana kl hamster bisa naik sepeda ya?
hihi...

genial said...
July 30, 2009 at 11:16 AM

apdeeeeeeeeeeeeeeeeeeeeeeeeeeeettt!!!

salam sayang :)

Omtomi said...
July 30, 2009 at 11:25 AM

Kunjungan balik sahabat blogger.
kini omtomi yang berkomentar diblog kamu..hehe

saya tertarik sekali dengan blog ini selain dengan beritanya yang sangat bermanfaat apalagi buat yang hobby pelihara hamster..pasti sangat membantu.

Sekali lagi saya omtomi mengucapkan salam kenal n Happy Blogging...success all.

cerita naruto said...
July 30, 2009 at 4:49 PM

lah harga tuh toilet buat hamster berapaan...??

berita unik said...
July 30, 2009 at 4:50 PM

dashyat...
ampe hal sedetil kayak gini di posting
ebat euy neng desti
kira2 apa yah postingan berikutnya

tak sabar menanti
inpo bagus buat hamster lover

♥ria♥ said...
July 30, 2009 at 5:46 PM

Waduh keren hamster punya toilet
enak tuh jd ga usah sering ganti2 popok di kandang ^^

arunaspot said...
July 30, 2009 at 11:23 PM

pokoke tunggu tanggal mainnya "the revenge of hamster toilet airspaceplane" *bahasanya kok aneh y...hihihi...

arunaspot said...
July 30, 2009 at 11:23 PM

bercerita tentang pembalasan makhluk antah berantah dari planet saturnus yg kehilangan pesawat ruang angkasanya...

arunaspot said...
July 30, 2009 at 11:24 PM

yg belakangan diketahui bahwa pesawatnya dengan sangat tidak hamsteriawi diubah menjadi toilet ?!!

arunaspot said...
July 30, 2009 at 11:25 PM

apakah kemudian akan menjadi sebuah pertempuran paling ngocoL di dunia perhamsteran ?

arunaspot said...
July 30, 2009 at 11:26 PM

thank you for reading my comment. Please give me moneyback.

Nadiah Effendy said...
July 31, 2009 at 1:01 AM

hi des, kunjungan dari malaysia.
bagus sekali infonya. ya hamster memang haiwan yang pembersih. jika ditambah aksesori toiletnya pasti cage akan kurang berbau.

genial said...
July 31, 2009 at 3:35 AM

kqkqkqkqqkkq... gw disuruh kemari lagi kirain uda apdet :p

秘密崇拜者 said...
July 31, 2009 at 4:04 AM

its so cute desty, it has been 2 years already i guest i have hamster, but unfortunately its already gone now.... (sad)

Blog Sederhana said...
July 31, 2009 at 12:38 PM

ternyata ga cuma orang y yg make toilet..

hamster juga...hehehe..


nambah informasi ni...nice...

www.fredyngahu.co.cc

danang said...
August 1, 2009 at 12:23 PM

wah,hebat.tp pa bner mreka mw ke toilet tu?? hehehe

lana said...
August 2, 2009 at 11:12 AM

wahhh... ada juga ya toilet buat hamster..
baru tau. hhe...

Pandu said...
August 2, 2009 at 4:34 PM

Wuiihhh....
pinter ya hamsternya...
bisa dibuatin toilet hamster segala...
hehehe... lutuna

Ica Puspitasari said...
August 26, 2009 at 7:26 PM

Toilet hamsterkuw pake batok kelapa di beri pasir & wewangian (bs bli d petshop)

Azzam said...
September 11, 2009 at 2:25 PM

Wah Hamster aja ngerti sanitasi apalagi yang punya nih.....

Azzam said...
September 11, 2009 at 3:12 PM

Halo Desty, Tukeran link donk....

chikmonk said...
October 9, 2009 at 1:11 AM

hahaha unik jga yach hamster itu
owh ya lam kenal ya des
backlink yu mo ga //
banner mu udah tak pasang di blogku..
gantian yach
http://chikmonk.web.id klo boleh di masukin ke blogmu namanya " blog chikmonk " mo ga ??

aboutgecko said...
August 6, 2011 at 12:11 AM

hewan unik neh ,.. tapi ane belum coba beliin toilet nih ,.. :)

ntar dah coba ,..:D

memememe said...
February 25, 2012 at 4:20 PM

Berarti nambah duit untuk hamsternya dong

hamster love ers said...
February 25, 2012 at 4:22 PM

Mahal gak toiletnya?

Novita Rahma said...
June 17, 2016 at 1:37 PM

Wahh unik sekali dan sangat lucu
Kunjungi juga www.smartkiosku.com

Nanda Merita said...
October 26, 2016 at 12:37 PM

wahhh kereenn, ide yang kreatif..
terima kasih untuk info dan tutornya, bisa diterapin di rumah.
jangan lupa kunjungi juga www.smartkiosku.com atau www.serbamultimedia.com yaa

Post a Comment

Thank you for reading my post. Please give me feedback.